Structure of PDB 3ktw Chain A

Receptor sequence
>3ktwA (length=92) Species: 2287 (Saccharolobus solfataricus) [Search protein sequence]
SLRDLKEENRIVIWPSYFFSPTRSKGRRLARIPYKIKTEELVSTLRELGL
DPIVIENKKYPRDRKINFLIAVKKVKSKNYTLKIIHNALMGT
3D structure
PDB3ktw Structural insights into the assembly of the human and archaeal signal recognition particles.
ChainA
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A R4 L6 K7 R11 V13 W15 Y18 T23 R24 S25 R28 R29 A31 K59 K60 Y61 P62 R63 R65 K75 S78 K79 N80 K84 R3 L5 K6 R10 V12 W14 Y17 T22 R23 S24 R27 R28 A30 K58 K59 Y60 P61 R62 R64 K74 S77 K78 N79 K83
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0008312 7S RNA binding
Biological Process
GO:0006612 protein targeting to membrane
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0005737 cytoplasm
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3ktw, PDBe:3ktw, PDBj:3ktw
PDBsum3ktw
PubMed20179341
UniProtQ980W2|SRP19_SACS2 Signal recognition particle 19 kDa protein (Gene Name=srp19)

[Back to BioLiP]