Structure of PDB 3kt3 Chain A

Receptor sequence

>3kt3A (length=409) Species: 4932 (Saccharomyces cerevisiae)

LKSTDVKEQVVTPWDVEGGVDEQGRAQNIDYDKLIKQFGTKPVNEETLKR
FKQVTGREPHHFLRKGLFFSERDFTKILDLYEQGKPFFLYTGRGPSSDSM
HLGHMIPFVFTKWLQEVFDVPLVIELTDDEKFLFKHKLTINDVKNFAREN
AKDIIAVGFDPKNTFIFSDLQYMGGAFYETVVRVSRQITGSTAKAVFGFN
DSDCIGKFHFASIQIATAFPSSFPNVLGLPDKTPCLIPCAIDQDPYFRVC
RDVADKLKYSKPALLHSRFFPALQGSTTKMSASDDTTAIFMTDTPKQIQK
KINKYAFSGGQVSADLHRELGGNPDVDVAYQYLSFFKDDDVFLKECYDKY
KSGELLSGEMKKLCIETLQEFVKAFQERRAQVDEETLDKFMVPHKLVWGE
KERLVAPKP

3D structure

• PDB: 3kt3 Crystal structures of Saccharomyces cerevisiae tryptophanyl-tRNA synthetase: new insights into the mechanism of tryptophan activation and implications for anti-fungal drug design
• Chain: A
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 6.1.1.2: tryptophan--tRNA ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	TYM	A	Y106 T107 G108 R109 G110 G119 H120 P123 E141 E146 K147 Q230 C255 A256 D258 Q259 F263 F285 F286 M296	Y90 T91 G92 R93 G94 G103 H104 P107 E125 E130 K131 Q214 C239 A240 D242 Q243 F247 F269 F270 M280
BS02	SO4	A	R109 H117 H120 S297 A298	R93 H101 H104 S281 A282
BS03	SO4	A	F148 T155 I156	F132 T139 I140

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004812 aminoacyl-tRNA ligase activity
• GO:0004830 tryptophan-tRNA ligase activity
• GO:0005524 ATP binding
• GO:1990825 sequence-specific mRNA binding

Biological Process

• GO:0006412 translation
• GO:0006418 tRNA aminoacylation for protein translation
• GO:0006436 tryptophanyl-tRNA aminoacylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3kt3, PDBe:3kt3, PDBj:3kt3
• PDBsum: 3kt3
• PubMed: 20123733
• UniProt: Q12109|SYWC_YEAST Tryptophan--tRNA ligase, cytoplasmic (Gene Name=WRS1)