Structure of PDB 3kq0 Chain A

Receptor sequence

>3kq0A (length=175) Species: 9606 (Homo sapiens) [Search protein sequence]

QIPLCANLVPVPITNATLDQITGKWFYIASAFRNEEYNKSVQEIQATFFY
FTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAH
LLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRI
PKSDVVYTDWKKDKCEPLEKQHEKE

3D structure

PDB

3kq0 The 1.8-A crystal structure of alpha1-acid glycoprotein (Orosomucoid) solved by UV RIP reveals the broad drug-binding activity of this human plasma lipocalin.

Chain

Resolution

1.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	JIM	A	S89 R90 F114	S89 R90 F114

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Biological Process
GO:0002682	regulation of immune system process
GO:0006953	acute-phase response
GO:0006954	inflammatory response
GO:0032715	negative regulation of interleukin-6 production
GO:0032720	negative regulation of tumor necrosis factor production
GO:0032731	positive regulation of interleukin-1 beta production
GO:0032732	positive regulation of interleukin-1 production
GO:0032760	positive regulation of tumor necrosis factor production

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0031093	platelet alpha granule lumen
GO:0035580	specific granule lumen
GO:0062023	collagen-containing extracellular matrix
GO:0070062	extracellular exosome
GO:0072562	blood microparticle
GO:1904724	tertiary granule lumen

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3kq0, PDBe:3kq0, PDBj:3kq0
PDBsum	3kq0
PubMed	18823996
UniProt	P02763\|A1AG1_HUMAN Alpha-1-acid glycoprotein 1 (Gene Name=ORM1)

[Back to BioLiP]