Structure of PDB 3knt Chain A

Receptor sequence

>3kntA (length=207) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence]

MMLIKKIEELKNSEIKDIIDKRIQEFKSFKNKSNEEWFKELCFCILTANF
TAEGGIRIQKEIGDGFLTLPREELEEKLKNLGHRFYRKRAEYIVLARRFK
NIKDIVESFENEKVAREFLVRNIKGIGYQEASHFLRNVGYDDVAIIDRHI
LRELYENNYIDEIPKTLSRRKYLEIENILRDIGEEVNLKLSELDLYIWYL
RTGKVLK

3D structure

PDB

3knt The C-terminal Lysine of Ogg2 DNA Glycosylases is a Major Molecular Determinant for Guanine/8-Oxoguanine Distinction.

Chain

Resolution

2.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

3.2.2.-
4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	T47 A48 N49 F50 T51 A52 R84 R89 K124 G125 G127 Q129 E130 I145 D147 R148 H149 R152 D194 W198 K207	T47 A48 N49 F50 T51 A52 R84 R89 K124 G125 G127 Q129 E130 I145 D147 R148 H149 R152 D194 W198 K207
BS02	dna	A	R84 F85 Y86 R87 K88	R84 F85 Y86 R87 K88
BS03	dna	A	K6 L10 S13 Y199	K6 L10 S13 Y199
BS04	dna	A	N177 I178 D181	N177 I178 D181

Gene Ontology

	Molecular Function
GO:0003824	catalytic activity
GO:0003906	DNA-(apurinic or apyrimidinic site) endonuclease activity
GO:0016798	hydrolase activity, acting on glycosyl bonds
GO:0016799	hydrolase activity, hydrolyzing N-glycosyl compounds
GO:0016829	lyase activity
GO:0140078	class I DNA-(apurinic or apyrimidinic site) endonuclease activity

	Biological Process
GO:0006281	DNA repair
GO:0006284	base-excision repair

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3knt, PDBe:3knt, PDBj:3knt
PDBsum	3knt
PubMed	20083120
UniProt	Q58134\|OGG1_METJA 8-oxoguanine DNA glycosylase/AP lyase (Gene Name=ogg)

[Back to BioLiP]