Structure of PDB 3kjl Chain A

Receptor sequence

>3kjlA (length=86) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

QLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNINEST
NFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEI

3D structure

PDB

3kjl Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1.

Chain

Resolution

2.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	N57 F58 T59	N51 F52 T53

Gene Ontology

	Molecular Function
GO:0003682	chromatin binding
GO:0003713	transcription coactivator activity
GO:0005515	protein binding
GO:0008047	enzyme activator activity

	Biological Process
GO:0000973	post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006325	chromatin organization
GO:0006357	regulation of transcription by RNA polymerase II
GO:0006368	transcription elongation by RNA polymerase II
GO:0006406	mRNA export from nucleus
GO:0015031	protein transport
GO:0016973	poly(A)+ mRNA export from nucleus
GO:0032880	regulation of protein localization
GO:0045893	positive regulation of DNA-templated transcription
GO:0045944	positive regulation of transcription by RNA polymerase II
GO:0051028	mRNA transport
GO:0071028	nuclear mRNA surveillance

	Cellular Component
GO:0000124	SAGA complex
GO:0000932	P-body
GO:0005634	nucleus
GO:0005643	nuclear pore
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0046695	SLIK (SAGA-like) complex
GO:0070390	transcription export complex 2
GO:0071819	DUBm complex

External links

PDB	RCSB:3kjl, PDBe:3kjl, PDBj:3kjl
PDBsum	3kjl
PubMed	20007317
UniProt	Q6WNK7\|SUS1_YEAST Transcription and mRNA export factor SUS1 (Gene Name=SUS1)