Structure of PDB 3kjf Chain A |
>3kjfA (length=140) Species: 9606 (Homo sapiens) [Search protein sequence] |
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKY EVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGP VDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIE |
|
PDB | 3kjf Kinetic and structural characterization of caspase-3 and caspase-8 inhibition by a novel class of irreversible inhibitors. |
Chain | A |
Resolution | 2.0 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
B92 |
A |
R64 H121 C163 |
R31 H88 C130 |
PDBbind-CN: -logKd/Ki=4.87,Ki=13.4uM |
|
|
|