Structure of PDB 3kik Chain A

Receptor sequence
>3kikA (length=94) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MDTAQLKSQIQQYLVESGNYELISNELKARLLQEGWVDKVKDLTKSEMNI
NESTNFTQILSTVEPKALEMVSDSTRETVLKQIREFLEEIVDTQ
3D structure
PDB3kik Structural basis for the interaction between yeast Spt-Ada-Gcn5 acetyltransferase (SAGA) complex components Sgf11 and Sus1
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide A L29 W38 V42 K47 M50 T56 F58 E66 A69 L70 R78 L82 I85 R86 L89 V93 Q96 L27 W36 V40 K45 M48 T54 F56 E64 A67 L68 R76 L80 I83 R84 L87 V91 Q94
BS02 peptide A N57 F58 T59 N55 F56 T57
BS03 peptide A V93 D94 Q96 V91 D92 Q94
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0008047 enzyme activator activity
Biological Process
GO:0000973 post-transcriptional tethering of RNA polymerase II gene DNA at nuclear periphery
GO:0006325 chromatin organization
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006368 transcription elongation by RNA polymerase II
GO:0006406 mRNA export from nucleus
GO:0015031 protein transport
GO:0016973 poly(A)+ mRNA export from nucleus
GO:0032880 regulation of protein localization
GO:0045893 positive regulation of DNA-templated transcription
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051028 mRNA transport
GO:0071028 nuclear mRNA surveillance
Cellular Component
GO:0000124 SAGA complex
GO:0000932 P-body
GO:0005634 nucleus
GO:0005643 nuclear pore
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0046695 SLIK (SAGA-like) complex
GO:0070390 transcription export complex 2
GO:0071819 DUBm complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3kik, PDBe:3kik, PDBj:3kik
PDBsum3kik
PubMed20007317
UniProtQ6WNK7|SUS1_YEAST Transcription and mRNA export factor SUS1 (Gene Name=SUS1)

[Back to BioLiP]