Structure of PDB 3khr Chain A

Receptor sequence

>3khrA (length=341) Species: 273057 (Saccharolobus solfataricus P2) [Search protein sequence]

GIVLFVDFDYFYAQVEEVLNPSLKGKPVVVCVFSGRFEDSGAVATANYEA
RKFGVKAGIPIVEAKKILPNAVYLPMRKEVYQQVSSRIMNLLREYSEKIE
IASIDEAYLDISDKVRDYREAYNLGLEIKNKILEKEKITVTVGISKNKVF
AKIAADMAKPNGIKVIDDEEVKRLIRELDIADVPGIGNITAEKLKKLGIN
KLVDTLSIEFDKLKGMIGEAKAKYLISLARDEYNEPIRTRVRKSIGRIVT
MKRNSRNLEEIKPYLFRAIEESYYKLDKRIPKAIHVVAVTEDLDIVSRGR
TFPHGISKETAYSESVKLLQKILEEDERKIRRIGVRFSKFI

3D structure

PDB

3khr Mechanism of error-free and semitargeted mutagenic bypass of an aromatic amine lesion by Y-family polymerase Dpo4.

Chain

Resolution

2.01 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.7.7.7: DNA-directed DNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	A	S103 E106 K152 G185 G187 I189 T190 V296 S297 R298 G299 T301	S103 E106 K152 G185 G187 I189 T190 V296 S297 R298 G299 T301
BS02	dna	A	V32 F37 S40 G41 A42 G218 A220 R242 K243 S244 I245 G246 R247 I248 T250 R331 R332	V32 F37 S40 G41 A42 G218 A220 R242 K243 S244 I245 G246 R247 I248 T250 R331 R332
BS03	TTP	A	Y10 F11 Y12 A44 T45 Y48 R51 A57 D105 K159	Y10 F11 Y12 A44 T45 Y48 R51 A57 D105 K159
BS04	CA	A	D7 D105 E106	D7 D105 E106
BS05	CA	A	D7 F8 D105	D7 F8 D105
BS06	CA	A	A181 I186	A181 I186
BS07	AF	A	R247 I248 V287 V335 R336	R247 I248 V287 V335 R336

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0003677	DNA binding
GO:0003684	damaged DNA binding
GO:0003887	DNA-directed DNA polymerase activity
GO:0046872	metal ion binding

	Biological Process
GO:0006260	DNA replication
GO:0006261	DNA-templated DNA replication
GO:0006281	DNA repair
GO:0006974	DNA damage response
GO:0042276	error-prone translesion synthesis

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3khr, PDBe:3khr, PDBj:3khr
PDBsum	3khr
PubMed	20154704
UniProt	Q97W02\|DPO4_SACS2 DNA polymerase IV (Gene Name=dbh)

[Back to BioLiP]