Structure of PDB 3kgz Chain A |
>3kgzA (length=145) Species: 395960 (Rhodopseudomonas palustris TIE-1) [Search protein sequence] |
SLRAQTAPGRWDGVAVMPYKQTAEAPFQDVSRQLLFADPNLACEWRYFEV DEGGYSTLERHAHVHAVMIHRGHGQCLVGETISDVAQGDLVFIPPMTWHQ FRANRGDCLGFLCVVNAARDRPQLPTADDLAELRKDERIADFIRT |
|
PDB | 3kgz Crystal structure of a cupin 2 conserved barrel domain protein from Rhodopseudomonas palustris |
Chain | A |
Resolution | 1.85 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
E76 H78 H82 H116 |
E59 H61 H65 H99 |
|
|
|