Structure of PDB 3kfg Chain A

Receptor sequence
>3kfgA (length=152) Species: 10090 (Mus musculus) [Search protein sequence]
LNVEKINGEWFSILLASDKREKIEEHGSMRVFVEHIHVLENSLAFKFHTV
IDGECSEIFLVADKTEKAGEYSVMYDGFNTFTILKTDYDNYIMFHLINEK
DGKTFQLMELYGRKADLNSDIKEKFVKLCEEHGIIKENIIDLTKTNRCLK
AR
3D structure
PDB3kfg High resolution X-ray structures of mouse major urinary protein nasal isoform in complex with pheromones.
ChainA
Resolution1.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 2EH A M38 V40 F54 L69 L116 E118 M29 V31 F45 L60 L107 E109
BS02 HTX A F54 F56 Y84 F90 F103 E118 F45 F47 Y75 F81 F94 E109
Gene Ontology
Molecular Function
GO:0005009 insulin receptor activity
GO:0005515 protein binding
GO:0005550 pheromone binding
GO:0036094 small molecule binding
Biological Process
GO:0006112 energy reserve metabolic process
GO:0007005 mitochondrion organization
GO:0008286 insulin receptor signaling pathway
GO:0009060 aerobic respiration
GO:0010628 positive regulation of gene expression
GO:0010888 negative regulation of lipid storage
GO:0010907 positive regulation of glucose metabolic process
GO:0031649 heat generation
GO:0042593 glucose homeostasis
GO:0045475 locomotor rhythm
GO:0045721 negative regulation of gluconeogenesis
GO:0045834 positive regulation of lipid metabolic process
GO:0045892 negative regulation of DNA-templated transcription
GO:0051055 negative regulation of lipid biosynthetic process
GO:0051897 positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0061179 negative regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0071396 cellular response to lipid
Cellular Component
GO:0005576 extracellular region
GO:0005615 extracellular space
GO:0005634 nucleus
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3kfg, PDBe:3kfg, PDBj:3kfg
PDBsum3kfg
PubMed20509168
UniProtP11590|MUP4_MOUSE Major urinary protein 4 (Gene Name=Mup4)

[Back to BioLiP]