Structure of PDB 3kf9 Chain A

Receptor sequence

>3kf9A (length=149) Species: 3190 (Scherffelia dubia) [Search protein sequence]

GLTEEQKQEIREAFDLFDTDGSGTIDAKELKVAMRALGFEPKKEEIKKMI
ADIDKDGSGTIDFEEFLQMMTAKMGERDSREEIMKAFRLFDDDETGKISF
KNLKRVAKELGENMTDEELQEMIDEADRDGDGEVNEEEFFRIMKKTSLF

3D structure

PDB

3kf9 Structural features of the complexes formed by Scherffelia dubia centrin

Chain

Resolution

2.6 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	A52
Catalytic site (residue number reindexed from 1)	A33
Enzyme Commision number	?

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	A	Q27 E28 E31 A32 L49 M53 F58 E64 K67 M68 M88 M89 E101 I102 E131 M141 A145 I161 M162 K164	Q8 E9 E12 A13 L30 M34 F39 E45 K48 M49 M69 M70 E82 I83 E112 M122 A126 I142 M143 K145
BS02	CA	A	D37 D39 S41 T43 E48	D18 D20 S22 T24 E29
BS03	CA	A	D73 D75 S77 T79 E84	D54 D56 S58 T60 E65
BS04	CA	A	D146 D148 D150 E152 E157	D127 D129 D131 E133 E138
BS05	CA	A	D110 D112 T114 K116 N121	D91 D93 T95 K97 N102

Gene Ontology

	Molecular Function
GO:0005509	calcium ion binding

View graph for
Molecular Function

External links

PDB	RCSB:3kf9, PDBe:3kf9, PDBj:3kf9
PDBsum	3kf9
PubMed
UniProt	Q06827\|CATR_SCHDU Caltractin

[Back to BioLiP]