Structure of PDB 3kd7 Chain A |
>3kd7A (length=102) Species: 32644 (unidentified) [Search protein sequence] |
NSAEAWKNLGNAYYKQGDYQKAIEYYQKALELDPNNASAWYNLGNAYYKQ GDYQKAIEYYQKALELDPNNAKAWYRRGNAYYKQGDYQKAIEDYQKALEL DP |
|
PDB | 3kd7 Crystal structure of a designed tetratricopeptide repeat module in complex with its peptide ligand. |
Chain | A |
Resolution | 2.85 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
Y20 K78 R82 |
Y14 K72 R76 |
|
|
|