Structure of PDB 3kbf Chain A

Receptor sequence
>3kbfA (length=156) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
SNRAVAVLRGETVTGTIWITQKSENDQAVIEGEIKGLTPGLHGFHVHQYG
DSTNGCISAGPHFNPFGKTHGGPKSEIRHVGDLGNVEAGADGVAKIKLTD
TLVTLYGPNTVVGRSMVVHAGQDDLGEGVGDKAEESKKTGNAGARAACGV
IALAAP
3D structure
PDB3kbf X-ray Crystal Structure of C. elegans Cu,Zn Superoxide Dismutase
ChainA
Resolution1.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H45 H47 H62 H70 H79 D82 H119 R145
Catalytic site (residue number reindexed from 1) H45 H47 H62 H70 H79 D82 H119 R145
Enzyme Commision number 1.15.1.1: superoxide dismutase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU A H45 H47 H119 H45 H47 H119
BS02 ZN A H62 H70 H79 D82 H62 H70 H79 D82
Gene Ontology
Molecular Function
GO:0004784 superoxide dismutase activity
GO:0005507 copper ion binding
GO:0016209 antioxidant activity
GO:0016491 oxidoreductase activity
GO:0042803 protein homodimerization activity
GO:0046872 metal ion binding
Biological Process
GO:0006801 superoxide metabolic process
GO:0019430 removal of superoxide radicals
GO:0040028 regulation of vulval development
GO:0060378 regulation of brood size
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3kbf, PDBe:3kbf, PDBj:3kbf
PDBsum3kbf
PubMed
UniProtP34697|SODC_CAEEL Superoxide dismutase [Cu-Zn] (Gene Name=sod-1)

[Back to BioLiP]