Structure of PDB 3kb8 Chain A

Receptor sequence

>3kb8A (length=201) Species: 261594 (Bacillus anthracis str. 'Ames Ancestor')

MHHHHHHSSGVGTENLYFQSNAMMNQDIEKVLISEEQIQEKVLELGAIIA
EDYKNTVPLAIGVLKGAMPFMADLLKRTDTYLEMDFMAVSSYGHSTVSTG
EVKILKDLDTSVEGRDILIVEDIIDSGLTLSYLVDLFKYRKAKSVKIVTL
LDKPTGRKVDLKADYVGFTVPHEFVVGYGLDYKEQYRNLPYVGVLKPSVY
S

3D structure

• PDB: 3kb8 2.09 Angstrom resolution structure of a hypoxanthine-guanine phosphoribosyltransferase (hpt-1) from Bacillus anthracis str. 'Ames Ancestor' in complex with GMP
• Chain: A
• Resolution: 2.09 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E99 D100 D103 F152 R165
• Catalytic site (residue number reindexed from 1): E121 D122 D125 F174 R187
• Enzyme Commision number: 2.4.2.8: hypoxanthine phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FRU	A	K19 E22 L23 I26 Y143 V144	K41 E44 L45 I48 Y165 V166
BS02	5GP	A	I101 D103 S104 G105 K131 F152 V153	I123 D125 S126 G127 K153 F174 V175

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0000287 magnesium ion binding
• GO:0004422 hypoxanthine phosphoribosyltransferase activity
• GO:0016757 glycosyltransferase activity
• GO:0046872 metal ion binding
• GO:0052657 guanine phosphoribosyltransferase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0006178 guanine salvage
• GO:0032263 GMP salvage
• GO:0032264 IMP salvage
• GO:0046100 hypoxanthine metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:3kb8, PDBe:3kb8, PDBj:3kb8
• PDBsum: 3kb8
• UniProt: B9ZW32