Structure of PDB 3k4z Chain A

Receptor sequence

>3k4zA (length=275) Species: 492476 (Acetivibrio thermocellus JW20)

MLEDNSSTLPPYKNDLLYERTFDEGLCYPWHTCEDSGGKCSFDVVDVPGQ
PGNKAFAVTVLDKGQNRWSVQMRHRGLTLEQGHTYRVRLKIWADASCKVY
IKIGQMGEPYAEYWNNKWSPYTLTAGKVLEIDETFVMDKPTDDTCEFTFH
LGGELAATPPYTVYLDDVSLYDPEYTKPVEYILPQPDVRVNQVGYLPEGK
KVATVVCNSTQPVKWQLKNAAGVVVLEGYTEPKGLDYVHWLDFSDFATEG
IGYYFELPTVNSPTNYSHPFDIRKD

3D structure

• PDB: 3k4z The unique binding mode of cellulosomal CBM4 from Clostridium thermocellum cellobiohydrolase A.
• Chain: A
• Resolution: 2.11 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BGC	A	W68 K102 Y110 H150	W68 K102 Y110 H150
BS02	BGC	A	D35 Q71 R73	D35 Q71 R73
BS03	MG	A	T21 D23 N53 K54 D166	T21 D23 N53 K54 D166
BS04	OXL	A	E80 E174	E80 E174
BS05	XGP	A	W68 K102 Y110 H150	W68 K102 Y110 H150

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Wed Dec 18 14:11:58 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3k4z', asym_id = 'A', title = 'The unique binding mode of cellulosomal CBM4 from Clostridium thermocellum cellobiohydrolase A.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3k4z', asym_id='A', title='The unique binding mode of cellulosomal CBM4 from Clostridium thermocellum cellobiohydrolase A.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0005975,0008810,0016798', uniprot = '', pdbid = '3k4z', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005975,0008810,0016798', uniprot='', pdbid='3k4z', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>