Structure of PDB 3k0j Chain A

Receptor sequence
>3k0jA (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]
TRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQA
FVIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKM
3D structure
PDB3k0j Thermodynamic analysis of ligand binding and ligand binding-induced tertiary structure formation by the thiamine pyrophosphate riboswitch.
ChainA
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna A Y213 N215 N216 E219 K222 D224 K227 K228 I243 R247 S248 L249 K250 M251 R252 Q254 F256 K280 R283 Q285 Y286 A287 K288 T289 D290 S291 D292 Y8 N10 N11 E14 K17 D19 K22 K23 I38 R42 S43 L44 K45 M46 R47 Q49 F51 K75 R78 Q80 Y81 A82 K83 T84 D85 S86 D87 PDBbind-CN: Kd=8.65nM
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:3k0j, PDBe:3k0j, PDBj:3k0j
PDBsum3k0j
PubMed19948769
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]