Structure of PDB 3jyq Chain A

Receptor sequence

>3jyqA (length=282) Species: 196627 (Corynebacterium glutamicum ATCC 13032)

NDSILLGLIGQGLDLSRTPAMHEAEGLAQGRATVYRRIDTLGSRASGQDL
KTLLDAALYLGFNGLNITHPYKQAVLPLLDEVSEQATQLGAVNTVVIDAT
GHTTGHNTDVSGFGRGMEEGLPNAKLDSVVQVGAGGVGNAVAYALVTHGV
QKLQVADLDTSRAQALADVINNAVGREAVVGVDARGIEDVIAAADGVVNA
TPMGMPAHPGTAFDVSCLTKDHWVGDVVYMPIETELLKAARALGCETLDG
TRMAIHQAVDAFRLFTGLEPDVSRMRETFLSL

3D structure

• PDB: 3jyq Enzyme-substrate complexes of the quinate/shikimate dehydrogenase from Corynebacterium glutamicum enable new insights in substrate and cofactor binding, specificity, and discrimination.
• Chain: A
• Resolution: 1.16 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.-
  1.1.1.24: quinate/shikimate dehydrogenase (NAD(+)).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAD	A	V133 G136 G137 V138 D158 L159 R163 T202 P203 M206 V228 A255	V132 G135 G136 V137 D157 L158 R162 T201 P202 M205 V227 A254
BS02	SKM	A	S17 N67 T69 N94 D110 Q258	S16 N66 T68 N93 D109 Q257

Gene Ontology

Molecular Function

• GO:0004764 shikimate 3-dehydrogenase (NADP+) activity
• GO:0016491 oxidoreductase activity
• GO:0030266 quinate 3-dehydrogenase (NAD+) activity
• GO:0050661 NADP binding
• GO:0052734 shikimate 3-dehydrogenase (NAD+) activity
• GO:0070403 NAD+ binding

Biological Process

• GO:0008652 amino acid biosynthetic process
• GO:0009073 aromatic amino acid family biosynthetic process
• GO:0009423 chorismate biosynthetic process
• GO:0019632 shikimate metabolic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3jyq, PDBe:3jyq, PDBj:3jyq
• PDBsum: 3jyq
• PubMed: 23929881
• UniProt: Q9X5C9|AROE_CORGL Quinate/shikimate dehydrogenase (NAD(+)) (Gene Name=aroE)