Structure of PDB 3jvk Chain A |
>3jvkA (length=128) Species: 10090 (Mus musculus) [Search protein sequence] |
AMGSTNPPPPETSNPNKPKRQTNQLQYLLRVVLKTLWKHQFAWPFQQPVD AVKLNLPDYYKIIKTPMDMGTIKKRLENNYYWNAQECIQDFNTMFTNCYI YNKPGDDIVLMAEALEKLFLQKINELPT |
|
PDB | 3jvk Structures of the Dual Bromodomains of the P-TEFb-activating Protein Brd4 at Atomic Resolution |
Chain | A |
Resolution | 1.8 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A |
L94 N140 I146 |
L56 N102 I108 |
|
|
|