Structure of PDB 3j16 Chain A

Receptor sequence

>3j16A (length=386) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

MKVISLKKDSFNKGGAVITLLPEDKEDLFTVYQIVDKDDELIFKKKFTSK
LDEAGKKKSTDLVKLKIKVISEDFDMKDEYLKYKGVTVTDESGASNVDIP
VGKYLSFTLDYVYPFTIIKQNFNKFMQKLLNEACNIEYKSDTAAVVLQEG
IAHVCLVTSSSTILKQKIEYSMPKKKRTTDVLKFDEKTEKFYKAIYSAMK
KDLNFDKLKTIILCSPGFYAKILMDKIFQYAEEEHNKKILDNKGMFFIAH
CSTGYLQGINEVLKNPLYASKLQDTKYSKEIMVMDEFLLHLNKDDDKAWY
GEKEVVKAAEYGAISYLLLTDKVLHSDNIAQREEYLKLMDSVESNGGKAL
VLSTLHSLGEELDQLTGIACILKYPLPDLDEDDGEE

3D structure

PDB

3j16 Structural basis of highly conserved ribosome recycling in eukaryotes and archaea.

Chain

Resolution

7.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	A	S10 F11 K45 K46 F47 S49 D52 K57 K58 Y80 K82 K84 T89 E91 V101 G102 K103 Y104 L105 S106	S10 F11 K45 K46 F47 S49 D52 K57 K58 Y80 K82 K84 T89 E91 V101 G102 K103 Y104 L105 S106
BS02	rna	A	Y113 E232 K237 D241 G312 I314 N345 K373 Y374 P375 L376	Y113 E232 K237 D241 G312 I314 N345 K373 Y374 P375 L376
BS03	rna	A	R177 T178 V181 L182 K183 E186 K187	R177 T178 V181 L182 K183 E186 K187

Gene Ontology

	Molecular Function
GO:0004521	RNA endonuclease activity
GO:0005515	protein binding
GO:0043022	ribosome binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation
GO:0006417	regulation of translation
GO:0010467	gene expression
GO:0016070	RNA metabolic process
GO:0032790	ribosome disassembly
GO:0045727	positive regulation of translation
GO:0045948	positive regulation of translational initiation
GO:0051301	cell division
GO:0051321	meiotic cell cycle
GO:0070481	nuclear-transcribed mRNA catabolic process, non-stop decay
GO:0070651	nonfunctional rRNA decay
GO:0070966	nuclear-transcribed mRNA catabolic process, no-go decay
GO:0071025	RNA surveillance
GO:0072344	rescue of stalled ribosome

	Cellular Component
GO:0005737	cytoplasm
GO:1990533	Dom34-Hbs1 complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3j16, PDBe:3j16, PDBj:3j16
PDBsum	3j16
PubMed	22358840
UniProt	P33309\|DOM34_YEAST Protein DOM34 (Gene Name=DOM34)

[Back to BioLiP]