Structure of PDB 3iu8 Chain A

Receptor sequence

>3iu8A (length=284) Species: 1773 (Mycobacterium tuberculosis)

PSRTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKMR
VAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFP
KSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGD
VADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRD
FTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIW
DDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL

3D structure

• PDB: 3iu8 Catalysis and Inhibition of Mycobacterium tuberculosis Methionine Aminopeptidase
• Chain: A
• Resolution: 1.85 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H114 D131 D142 G204 H205 G208 H212 L215 E238 N242 E269
• Catalytic site (residue number reindexed from 1): H113 D130 D141 G203 H204 G207 H211 L214 E237 N241 E268
• Enzyme Commision number: 3.4.11.18: methionyl aminopeptidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	T03	A	Y97 C105 H114 D131 D142 H205 E238 W255 E269	Y96 C104 H113 D130 D141 H204 E237 W254 E268	MOAD: ic50=0.58uM PDBbind-CN: -logKd/Ki=6.24,IC50=0.58uM

Gene Ontology

Molecular Function

• GO:0004177 aminopeptidase activity
• GO:0004239 initiator methionyl aminopeptidase activity
• GO:0005506 iron ion binding
• GO:0008235 metalloexopeptidase activity
• GO:0046872 metal ion binding
• GO:0046914 transition metal ion binding
• GO:0050897 cobalt ion binding
• GO:0070006 metalloaminopeptidase activity

Biological Process

• GO:0006508 proteolysis
• GO:0016485 protein processing

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3iu8, PDBe:3iu8, PDBj:3iu8
• PDBsum: 3iu8
• PubMed: 20038112
• UniProt: P9WK19|MAP12_MYCTU Methionine aminopeptidase 2 (Gene Name=map)