Structure of PDB 3iu7 Chain A

Receptor sequence
>3iu7A (length=284) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
PSRTALSPGVLSPTRPVPNWIARPEYVGKPAAQEGSEPWVQTPEVIEKMR
VAGRIAAGALAEAGKAVAPGVTTDELDRIAHEYLVDNGAYPSTLGYKGFP
KSCCTSLNEVICHGIPDSTVITDGDIVNIDVTAYIGGVHGDTNATFPAGD
VADEHRLLVDRTREATMRAINTVKPGRALSVIGRVIESYANRFGYNVVRD
FTGHGIGTTFHNGLVVLHYDQPAVETIMQPGMTFTIEPMINLGALDYEIW
DDGWTVVTKDRKWTAQFEHTLLVTDTGVEILTCL
3D structure
PDB3iu7 Catalysis and Inhibition of Mycobacterium tuberculosis Methionine Aminopeptidase
ChainA
Resolution1.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H114 D131 D142 G204 H205 G208 H212 L215 E238 N242 E269
Catalytic site (residue number reindexed from 1) H113 D130 D141 G203 H204 G207 H211 L214 E237 N241 E268
Enzyme Commision number 3.4.11.18: methionyl aminopeptidase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN A D131 D142 E269 D130 D141 E268
BS02 MN A D142 H205 T236 E238 E269 D141 H204 T235 E237 E268
BS03 FCD A Y97 H114 D131 D142 H205 H212 W255 E269 Y96 H113 D130 D141 H204 H211 W254 E268 MOAD: ic50=16uM
PDBbind-CN: -logKd/Ki=4.80,IC50=16uM
BS04 FCD A N144 R164 M168 F268 E269 H270 N143 R163 M167 F267 E268 H269 MOAD: ic50=16uM
PDBbind-CN: -logKd/Ki=4.80,IC50=16uM
Gene Ontology
Molecular Function
GO:0004177 aminopeptidase activity
GO:0004239 initiator methionyl aminopeptidase activity
GO:0005506 iron ion binding
GO:0008235 metalloexopeptidase activity
GO:0046872 metal ion binding
GO:0046914 transition metal ion binding
GO:0050897 cobalt ion binding
GO:0070006 metalloaminopeptidase activity
Biological Process
GO:0006508 proteolysis
GO:0016485 protein processing
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3iu7, PDBe:3iu7, PDBj:3iu7
PDBsum3iu7
PubMed20038112
UniProtP9WK19|MAP12_MYCTU Methionine aminopeptidase 2 (Gene Name=map)

[Back to BioLiP]