Structure of PDB 3iu6 Chain A |
>3iu6A (length=143) Species: 9606 (Homo sapiens) [Search protein sequence] |
MNVTLLIQELIHNLFVSVMSHQDDEGRCYSDSLAEIPAVDPNFPNKPPLT FDIIRKNVENNRYRRLDLFQEHMFEVLERARRMNRTDSEIYEDAVELQQF FIKIRDELCKNGEILLSPALSYTTKHLHNDVEKERKEKLPKEI |
|
PDB | 3iu6 Histone recognition and large-scale structural analysis of the human bromodomain family. |
Chain | A |
Resolution | 1.79 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H751 E798 |
H12 E59 |
|
|
|
|