Structure of PDB 3iu2 Chain A

Receptor sequence

>3iu2A (length=382) Species: 9606 (Homo sapiens)

RSYQFWDTQPVPKLGEVVNTHGPVEPDKDNIRQEPYTLPQGFTWDALDLG
DRGVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLPQWHCGV
RVVSSRKLVGFISAIPANIHIYDTEKKMVEINFLCVHKKLRSKRVAPVLI
REITRRVHLEGIFQAVYTAGVVLPKPVGTCRYWHRSLNPRKLIEVKFSHL
SRNMTMQRTMKLYRLPETPKTAGLRPMETKDIPVVHQLLTRYLKQFHLTP
VMSQEEVEHWFYPQENIIDTFVVENANGEVTDFLSFYTLPSTIMNHPTHK
SLKAAYSFYNVHTQTPLLDLMSDALVLAKMKGFDVFNALDLMENKTFLEK
LKFGIGDGNLQYYLYNWKCPSMGAEKVGLVLQ

3D structure

• PDB: 3iu2 Crystal Structure of human type-I N-myristoyltransferase with bound myristoyl-CoA and inhibitor DDD90096
• Chain: A
• Resolution: 1.73 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): N246 F247 L248 T282 Q496
• Catalytic site (residue number reindexed from 1): N132 F133 L134 T168 Q382
• Enzyme Commision number: 2.3.1.-
  2.3.1.97: glycylpeptide N-tetradecanoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MYA	A	Y117 Q118 F119 W120 Y180 V181 I245 L248 V250 R255 S256 R258 A260 T268 V271 F277 A279 Y281 T282 L287 Y479	Y3 Q4 F5 W6 Y66 V67 I131 L134 V136 R141 S142 R144 A146 T154 V157 F163 A165 Y167 T168 L173 Y365
BS02	096	A	V181 E182 D183 F188 F190 G284 Y296 H298 F311 S405 Y420	V67 E68 D69 F74 F76 G170 Y182 H184 F197 S291 Y306

Gene Ontology

Molecular Function

• GO:0004379 glycylpeptide N-tetradecanoyltransferase activity

Biological Process

• GO:0006499 N-terminal protein myristoylation

External links

• PDB: RCSB:3iu2, PDBe:3iu2, PDBj:3iu2
• PDBsum: 3iu2
• UniProt: P30419|NMT1_HUMAN Glycylpeptide N-tetradecanoyltransferase 1 (Gene Name=NMT1)