Structure of PDB 3iq5 Chain A

Receptor sequence

>3iq5A (length=106) Species: 562 (Escherichia coli)

ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLED
KSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKCTCNA
CHQKYR

3D structure

• PDB: 3iq5 Evolution of metal selectivity in templated protein interfaces.
• Chain: A
• Resolution: 2.05 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	E4 M7 E8 N11 F61 F65 L68 C98 C101 H102 R106	E4 M7 E8 N11 F61 F65 L68 C98 C101 H102 R106

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0022900 electron transport chain

Cellular Component

• GO:0042597 periplasmic space

External links

• PDB: RCSB:3iq5, PDBe:3iq5, PDBj:3iq5
• PDBsum: 3iq5
• PubMed: 20515031
• UniProt: P0ABE7|C562_ECOLX Soluble cytochrome b562 (Gene Name=cybC)