Structure of PDB 3ipb Chain A

Receptor sequence

>3ipbA (length=115) Species: 9606 (Homo sapiens)

CPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLT
TEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAA
LLSPYSYSTTAVVTN

3D structure

• PDB: 3ipb Trapping of palindromic ligands within native transthyretin prevents amyloid formation.
• Chain: A
• Resolution: 1.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	JZD	A	L17 A108 S117 T119	L8 A99 S108 T110	MOAD: ic50=0.2uM PDBbind-CN: -logKd/Ki=6.70,IC50=0.2uM
BS02	JZD	A	K15 S117	K6 S108	MOAD: ic50=0.2uM PDBbind-CN: -logKd/Ki=6.70,IC50=0.2uM

Gene Ontology

Molecular Function

• GO:0005179 hormone activity
• GO:0005515 protein binding
• GO:0042802 identical protein binding
• GO:0070324 thyroid hormone binding

Biological Process

• GO:0006144 purine nucleobase metabolic process
• GO:0007165 signal transduction

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0005737 cytoplasm
• GO:0035578 azurophil granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3ipb, PDBe:3ipb, PDBj:3ipb
• PDBsum: 3ipb
• PubMed: 21059958
• UniProt: P02766|TTHY_HUMAN Transthyretin (Gene Name=TTR)