Structure of PDB 3io3 Chain A

Receptor sequence
>3io3A (length=230) Species: 4959 (Debaryomyces hansenii) [Search protein sequence]
DLELEPTLESIVQHDSLKWIFVGGKGGVGKTTTSSSVAVQLALAQPNEQF
LLISTDPAHNLSDAFCQKFGKDARKVEGLPNLSCMEIDPYKTIIFDTAPT
GHTLRFLQSEVNEQFTNPELTTFICVCISEFLSLYETERMIQELMSYNMD
VNSIVVNQLLFAECKRCESRWKMQKKYLDQMGELYEDYHLVKMPLLGCEI
RGVENLKKFSKFLLKPYDPKADSDIVFDLE
3D structure
PDB3io3 The crystal structures of yeast Get3 suggest a mechanism for tail-anchored protein membrane insertion
ChainA
Resolution1.8 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G28 G30 K31 T32 T33 D57
Catalytic site (residue number reindexed from 1) G27 G29 K30 T31 T32 D56
Enzyme Commision number 3.6.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP A G28 G30 K31 T32 T33 N268 P310 L311 L312 E315 I316 G27 G29 K30 T31 T32 N157 P194 L195 L196 E199 I200
BS02 ZN A C280 C283 C164 C167
Gene Ontology
Molecular Function
GO:0005524 ATP binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0046872 metal ion binding
Biological Process
GO:0006620 post-translational protein targeting to endoplasmic reticulum membrane
GO:0045048 protein insertion into ER membrane
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005794 Golgi apparatus
GO:0043529 GET complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3io3, PDBe:3io3, PDBj:3io3
PDBsum3io3
PubMed19956640
UniProtQ6BSM0|GET3_DEBHA ATPase GET3 (Gene Name=GET3)

[Back to BioLiP]