Structure of PDB 3ims Chain A |
>3imsA (length=115) Species: 9606 (Homo sapiens) [Search protein sequence] |
PLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFASGKTSESGELHGLTT EEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAAL LSPYSYSTTAVVTNP |
|
PDB | 3ims A substructure combination strategy to create potent and selective transthyretin kinetic stabilizers that prevent amyloidogenesis and cytotoxicity. |
Chain | A |
Resolution | 1.4 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
IW2 |
A |
K15 A108 A109 S117 |
K5 A98 A99 S107 |
|
|
|
|