Structure of PDB 3ilo Chain A

Receptor sequence
>3iloA (length=158) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQ
PDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLAIML
FGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTR
AFDKLNKW
3D structure
PDB3ilo Catalytic center assembly of HPPK as revealed by the crystal structure of a ternary complex at 1.25 A resolution
ChainA
Resolution1.1 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) R82 R92 D95 A97
Catalytic site (residue number reindexed from 1) R82 R92 D95 A97
Enzyme Commision number 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 APC A Q74 R82 R84 R92 D95 I98 R110 L111 T112 Y116 R121 Q74 R82 R84 R92 D95 I98 R110 L111 T112 Y116 R121
BS02 PH2 A T42 P43 L45 Y53 N55 W89 R92 F123 T42 P43 L45 Y53 N55 W89 R92 F123
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003848 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase activity
GO:0005524 ATP binding
GO:0016301 kinase activity
Biological Process
GO:0009396 folic acid-containing compound biosynthetic process
GO:0016310 phosphorylation
GO:0046654 tetrahydrofolate biosynthetic process
GO:0046656 folic acid biosynthetic process

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:3ilo, PDBe:3ilo, PDBj:3ilo
PDBsum3ilo
PubMed
UniProtP26281|HPPK_ECOLI 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (Gene Name=folK)

[Back to BioLiP]