Structure of PDB 3ilm Chain A |
>3ilmA (length=112) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence] |
SDAHVLKSRLEWGEPAFTILDVRDRSTYNDGHIMGAMAMPIEDLVDRASS SLEKSRDIYVYGAGDEQTSQAVNLLRSAGFEHVSELKGGLAAWKAIGGPT EGIIVSRMQNHL |
|
PDB | 3ilm Crystal Structure of the Alr3790 protein from Anabaena sp. |
Chain | A |
Resolution | 2.262 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
A |
H51 E120 |
H32 E101 |
|
|
|