Structure of PDB 3ild Chain A |
>3ildA (length=148) Species: 235266 (Captovirus AFV1) [Search protein sequence] |
VEYEVVSKNLTSKMSHELLFSVKKRWFVKPFRHDRQLGKLHYKLLPGNYI AFGLYVLKNQDYARFEIAWVHVDKDGKIEERTVYSIETYWHIFIDIENDL NCPYVLAKFIEMRPEFHKTAWVEESNYSIAEDDIQMVESIKRYLERKI |
|
PDB | 3ild ORF157 from the archaeal virus Acidianus filamentous virus 1 defines a new class of nuclease |
Chain | A |
Resolution | 3.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
H77 D79 |
H71 D73 |
|
|
|