Structure of PDB 3iil Chain A

Receptor sequence

>3iilA (length=175) Species: 9606 (Homo sapiens)

PEFMLLPNILLTGTPGVGKTTLGKELASKSGLKYINVGDLAREEQLYDGY
DEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRT
DTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSN
KPEELENNVDQILKWIEQWIKDHNS

3D structure

• PDB: 3iil hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Enzyme Commision number: 2.7.4.3: adenylate kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ADP	A	G13 G15 K16 T17 T18 R105 R109 N147 K148 P149	G16 G18 K19 T20 T21 R108 R112 N150 K151 P152
BS02	MG	A	P-2 E-1	P1 E2
BS03	SO4	A	Y129 H142 Q143	Y132 H145 Q146

Gene Ontology

Molecular Function

• GO:0004017 adenylate kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016301 kinase activity
• GO:0016887 ATP hydrolysis activity
• GO:0050145 nucleoside monophosphate kinase activity

Biological Process

• GO:0006364 rRNA processing
• GO:0015949 nucleobase-containing small molecule interconversion
• GO:0016310 phosphorylation
• GO:0042254 ribosome biogenesis
• GO:0042274 ribosomal small subunit biogenesis
• GO:0046940 nucleoside monophosphate phosphorylation

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005813 centrosome
• GO:0015030 Cajal body
• GO:0016020 membrane
• GO:0016607 nuclear speck

External links

• PDB: RCSB:3iil, PDBe:3iil, PDBj:3iil
• PDBsum: 3iil
• PubMed: 22038794
• UniProt: Q9Y3D8|KAD6_HUMAN Adenylate kinase isoenzyme 6 (Gene Name=AK6)