Structure of PDB 3ifj Chain A |
>3ifjA (length=139) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence] |
CLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWFD QGTRDVIGLRIAGGAIVWATPDHKVLTEYGWRAAGELRKGDRVAVRDVET GELRYSVIREVLPTRRARTYDLEVEELHTLVAEGVVVHN |
|
PDB | 3ifj Selection and structure of hyperactive inteins: peripheral changes relayed to the catalytic center. |
Chain | A |
Resolution | 1.9 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
E424 H429 X440 |
E123 H128 X139 |
|
|
|
|