Structure of PDB 3i0x Chain A

Receptor sequence

>3i0xA (length=291) Species: 1488 (Clostridium acetobutylicum)

MDFDMIEEKKDSVIVRNVENFELKDIFDCGQCFRWHRQENGNYIGIAFEK
VVEVQKIGEDVVIYNINEEEFKNVWSEYFDLYRDYGEIKKELSRDPLLKK
SVDFGEGIRILRQDPFEILLSFIISANNRIPMIKKCINNISEKAGKKLEY
KGKIYYAFPTVDKLHEFTEKDFEECTAGFRAKYLKDTVDRIYNGELNLEY
IKSLNDNECHEELKKFMGVGPQVADCIMLFSMQKYSAFPVDTWVKKAMMS
LYVAPDVSLKKIRDFGREKFGSLSGFAQQYLFYYARENNIQ

3D structure

• PDB: 3i0x Structural basis for the lack of opposite base specificity of Clostridium acetobutylicum 8-oxoguanine DNA glycosylase.
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Q222 D241
• Catalytic site (residue number reindexed from 1): Q222 D241
• Enzyme Commision number: 4.2.99.18: DNA-(apurinic or apyrimidinic site) lyase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	G30 S125 A126 N127 N128 R129 I130 F179 Y183 M217 G218 G220 P221 Q222 V223 P239 D241 T242 W243 K246 Q278 F282 R286	G30 S125 A126 N127 N128 R129 I130 F179 Y183 M217 G218 G220 P221 Q222 V223 P239 D241 T242 W243 K246 Q278 F282 R286
BS02	dna	A	N127 R129 M132 F179 K260	N127 R129 M132 F179 K260

Gene Ontology

Molecular Function

• GO:0003684 damaged DNA binding
• GO:0003824 catalytic activity
• GO:0008534 oxidized purine nucleobase lesion DNA N-glycosylase activity
• GO:0140097 catalytic activity, acting on DNA

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0006289 nucleotide-excision repair

External links

• PDB: RCSB:3i0x, PDBe:3i0x, PDBj:3i0x
• PDBsum: 3i0x
• PubMed: 19747886
• UniProt: Q97FM4