Structure of PDB 3i0l Chain A

Receptor sequence

>3i0lA (length=272) Species: 9606 (Homo sapiens)

MVYPQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGL
TVFAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGR
QLSVLEVGDVSMRRMEMISDFSERRFLSEVDYLVSVDVDMEFRDHVGVEI
LTPLFGTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSV
QEVQRLTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYL
WDQQLLGWPAVLRKLRFTAVPK

3D structure

• PDB: 3i0l Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding
• Chain: A
• Resolution: 1.6 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H233 M266 W300 E303 A343
• Catalytic site (residue number reindexed from 1): H159 M192 W226 E229 A269
• Enzyme Commision number: 2.4.1.37: fucosylgalactoside 3-alpha-galactosyltransferase.
  2.4.1.40: glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	UDP	A	P72 S80 G98 T99 F100 N101	P4 S12 G30 T31 F32 N33
BS02	UDP	A	F121 A122 I123 Y126 D211 V212 D213	F53 A54 I55 Y58 D137 V138 D139
BS03	GAL	A	G267 W300 H301 D302 E303	G193 W226 H227 D228 E229

Gene Ontology

Molecular Function

• GO:0016758 hexosyltransferase activity

Biological Process

• GO:0005975 carbohydrate metabolic process

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:3i0l, PDBe:3i0l, PDBj:3i0l
• PDBsum: 3i0l
• PubMed: 20655926
• UniProt: P16442|BGAT_HUMAN Histo-blood group ABO system transferase (Gene Name=ABO)