Structure of PDB 3i0f Chain A

Receptor sequence

>3i0fA (length=268) Species: 9606 (Homo sapiens)

YPQPKVLTPSRKDVLVVTPWLAPIVWEGTFNIDILNEQFRLQNTTIGLTV
FAIKKYVAFLKLFLETAEKHFMVGHRVHYYVFTDQPAAVPRVTLGTGRQL
SVLEVGMRRMEMISDFSERRFLSEVDYLVCVDVDMEFRDHVGVEILTPLF
GTLHPSFYGSSREAFTYERRPQSQAYIPKDEGDFYYMGAFFGGSVQEVQR
LTRACHQAMMVDQANGIEAVWHDESHLNKYLLRHKPTKVLSPEYLWDQQL
LGWPAVLRKLRFTAVPKN

3D structure

• PDB: 3i0f Cysteine-to-serine mutants dramatically reorder the active site of human ABO(H) blood group B glycosyltransferase without affecting activity: structural insights into cooperative substrate binding
• Chain: A
• Resolution: 1.56 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H233 M266 W300 E303 A343
• Catalytic site (residue number reindexed from 1): H154 M187 W221 E224 A264
• Enzyme Commision number: 2.4.1.37: fucosylgalactoside 3-alpha-galactosyltransferase.
  2.4.1.40: glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FUC	A	M266 D326	M187 D247
BS02	U	A	P72 S80 G98 T99 F100	P2 S10 G28 T29 F30
BS03	UDP	A	F121 A122 I123 Y126 D211 V212 D213 K346	F51 A52 I53 Y56 D132 V133 D134 K267
BS04	MN	A	D211 D213	D132 D134

Gene Ontology

Molecular Function

• GO:0016758 hexosyltransferase activity

Biological Process

• GO:0005975 carbohydrate metabolic process

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:3i0f, PDBe:3i0f, PDBj:3i0f
• PDBsum: 3i0f
• PubMed: 20655926
• UniProt: P16442|BGAT_HUMAN Histo-blood group ABO system transferase (Gene Name=ABO)