Structure of PDB 3hzx Chain A

Receptor sequence

>3hzxA (length=129) Species: 1280 (Staphylococcus aureus)

LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFT
KKMKENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVA
YVYKGNNTHEQLLRKAEAQAKKEKLNIWS

3D structure

• PDB: 3hzx Structure of Staphylococcal nuclease D+PHS/V66K reveals internal hydration in protein cavity
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D21 R35 D40 T41 E43 R87
• Catalytic site (residue number reindexed from 1): D15 R29 D34 T35 E37 R75
• Enzyme Commision number: 3.1.31.1: micrococcal nuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CA	A	D21 D40 T41 E43	D15 D34 T35 E37
BS02	THP	A	R35 K84 Y85 R87 L89 Y113 Y115	R29 K72 Y73 R75 L77 Y101 Y103

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004518 nuclease activity

External links

• PDB: RCSB:3hzx, PDBe:3hzx, PDBj:3hzx
• PDBsum: 3hzx
• UniProt: P00644|NUC_STAAU Thermonuclease (Gene Name=nuc)