Structure of PDB 3hzh Chain A |
>3hzhA (length=134) Species: 139 (Borreliella burgdorferi) [Search protein sequence] |
SKPRGINYDTGIPFNVLIVDDSVFTVKQLTQIFTSEGFNIIDTAADGEEA VIKYKNHYPNIDIVTLDITMPKMDGITCLSNIMEFDKNARVIMISALGKE QLVKDCLIKGAKTFIVKPLDRAKVLQRVMSVFVK |
|
PDB | 3hzh Identical phosphatase mechanisms achieved through distinct modes of binding phosphoprotein substrate. |
Chain | A |
Resolution | 1.96 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
A |
D33 X79 T81 |
D21 X67 T69 |
|
|
|
|