Structure of PDB 3hyp Chain A

Receptor sequence

>3hypA (length=117) Species: 817 (Bacteroides fragilis)

GTIHLTRAEFLKKIADYENHSKEWKYLGDKPAIVDFYADWCGPCKMVAPI
LEELSKEYAGKIYIYKVNVDKEPELARDFGIQGIPTIWFVPMKGEPQVNM
GALSKEQLKGYIDKVLL

3D structure

• PDB: 3hyp In vivo oxidative protein folding can be facilitated by oxidation-reduction cycling
• Chain: A
• Resolution: 2.899 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): C63 G64 P65 C66
• Catalytic site (residue number reindexed from 1): C41 G42 P43 C44

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	A	E96 D100	E74 D78

Gene Ontology

Molecular Function

• GO:0015035 protein-disulfide reductase activity
• GO:0046872 metal ion binding

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3hyp, PDBe:3hyp, PDBj:3hyp
• PDBsum: 3hyp
• PubMed: 19968787
• UniProt: Q64SV7