Structure of PDB 3hy6 Chain A

Receptor sequence
>3hy6A (length=198) Species: 9606 (Homo sapiens) [Search protein sequence]
MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSK
RISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEE
ISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGK
GYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYE
3D structure
PDB3hy6 Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 MG A R84 F85 R84 F85
BS02 MG A L104 P105 K106 L104 P105 K106
BS03 PO4 A R145 G151 Y152 Y153 R145 G151 Y152 Y153
BS04 MG A M92 L124 Y156 M92 L124 Y156
BS05 MG A D154 D189 D154 D189
BS06 ADP A K10 R14 G147 G149 G151 D154 K10 R14 G147 G149 G151 D154
BS07 MG A N144 D189 N144 D189
BS08 MG A E100 R120 E100 R120
BS09 MG A Y197 E198 Y197 E198
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0005542 folic acid binding
GO:0016874 ligase activity
GO:0030272 5-formyltetrahydrofolate cyclo-ligase activity
GO:0046872 metal ion binding
Biological Process
GO:0006536 glutamate metabolic process
GO:0009396 folic acid-containing compound biosynthetic process
GO:0015942 formate metabolic process
GO:0035999 tetrahydrofolate interconversion
GO:0046653 tetrahydrofolate metabolic process
GO:0046655 folic acid metabolic process
GO:0046657 folic acid catabolic process
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3hy6, PDBe:3hy6, PDBj:3hy6
PDBsum3hy6
PubMed19738041
UniProtP49914|MTHFS_HUMAN 5-formyltetrahydrofolate cyclo-ligase (Gene Name=MTHFS)

[Back to BioLiP]