Structure of PDB 3hy3 Chain A

Receptor sequence

>3hy3A (length=196) Species: 9606 (Homo sapiens)

MAAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSK
RISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEE
ISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGK
GYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNDMKVDEVLYE

3D structure

• PDB: 3hy3 Structural basis for the inhibition of human 5,10-methenyltetrahydrofolate synthetase by N10-substituted folate analogues
• Chain: A
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 6.3.3.2: 5-formyltetrahydrofolate cyclo-ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	10F	A	F55 L56 M58 E61 Y83 F85 W109 R148 G149 K150 Y152	F55 L56 M58 E61 Y83 F85 W109 R148 G149 K150 Y152
BS02	MG	A	M92 L124 Y156	M92 L124 Y156
BS03	MG	A	F85 T107 S108	F85 T107 S108
BS04	MG	A	R84 F85 Q86	R84 F85 Q86
BS05	MG	A	H89 R159	H89 R159

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0005542 folic acid binding
• GO:0016874 ligase activity
• GO:0030272 5-formyltetrahydrofolate cyclo-ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006536 glutamate metabolic process
• GO:0009396 folic acid-containing compound biosynthetic process
• GO:0015942 formate metabolic process
• GO:0035999 tetrahydrofolate interconversion
• GO:0046653 tetrahydrofolate metabolic process
• GO:0046655 folic acid metabolic process
• GO:0046657 folic acid catabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005759 mitochondrial matrix
• GO:0005829 cytosol

External links

• PDB: RCSB:3hy3, PDBe:3hy3, PDBj:3hy3
• PDBsum: 3hy3
• PubMed: 19738041
• UniProt: P49914|MTHFS_HUMAN 5-formyltetrahydrofolate cyclo-ligase (Gene Name=MTHFS)