Structure of PDB 3hxy Chain A

Receptor sequence

>3hxyA (length=441) Species: 83333 (Escherichia coli K-12)

SKSTAEIRQAFLDFFHSKGHQVVASSSLVPHNDPTLLFTNAGMNQFKDVF
LGLDKRNYSRATTSQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGD
YFKLDAILFAWLLLTSEKWFALPKERLWVTVYESDDEAYEIWEKEVGIPR
ERIIRIGDNKGAPYASDNFWQMGDTGPCGPCTEIFYDHGDHIWGGPPGSP
EEDGDRYIEIWNIVFMQFNRQADGTMEPLPKPSVDTGMGLERIAAVLQHV
NSNYDIDLFRTLIQAVAKVTGATDLSNKSLRVIADHIRSCAFLIADGVMP
SNENRGYVLRRIIRRAVRHGNMLGAKETFFYKLVGPLIDVMGSAGEDLKR
QQAQVEQVLKTEEEQFARTLERGLALLDEELAKLSGDTLDGETAFRLYDT
YGFPVDLTADVCRERNIKVDEAGFEAAMEEQRRRAREASGF

3D structure

• PDB: 3hxy Paradox of mistranslation of serine for alanine caused by AlaRS recognition dilemma.
• Chain: A
• Resolution: 2.27 Å

Enzymatic activity

• Enzyme Commision number: 6.1.1.7: alanine--tRNA ligase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	5AL	A	R69 D76 H86 H87 F90 M92 W170 E209 N212 D235 G237 R242	R69 D76 H86 H87 F90 M92 W170 E209 N212 D235 G237 R242
BS02	MDN	A	R85 H86 E209 R242	R85 H86 E209 R242
BS03	ACP	A	R69 D76 R85 H86 H87 F90 M92 E209 I210 N212 G237 G239 R242	R69 D76 R85 H86 H87 F90 M92 E209 I210 N212 G237 G239 R242
BS04	MG	A	E183 E209	E183 E209
BS05	MG	A	D167 E183 E209	D167 E183 E209

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003676 nucleic acid binding
• GO:0004813 alanine-tRNA ligase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006419 alanyl-tRNA aminoacylation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:3hxy, PDBe:3hxy, PDBj:3hxy
• PDBsum: 3hxy
• PubMed: 20010690
• UniProt: P00957|SYA_ECOLI Alanine--tRNA ligase (Gene Name=alaS)