Structure of PDB 3hxg Chain A

Receptor sequence
>3hxgA (length=183) Species: 6183 (Schistosoma mansoni) [Search protein sequence]
EFPHPLQDSWSYYLFQFRKALDWDECLEKVATFSTIEDFWSVLTHTVRPR
EITYGKDLYMFKSDIMPKWEDPKNENGGRWLINVTARQDVDFLWDELLML
LIGSDWDTDEEDRQICGAVFQPRSRGSKLSVWLTSDNEEETILSIGRRIK
ERLELEDTIYFQPVSDQRSQTRGSDICTGKYEI
3D structure
PDB3hxg Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap.
ChainA
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 peptide A H24 P25 Q27 I56 W60 E116 M119 G123 S124 W126 D127 T128 D129 H4 P5 Q7 I36 W40 E96 M99 G103 S104 W106 D107 T108 D109
BS02 GTA A F37 W43 K88 W89 E90 Q141 R143 K148 R192 F17 W23 K68 W69 E70 Q121 R123 K128 R172 MOAD: Kd=0.27uM
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Thu Nov 28 19:43:22 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '3hxg', asym_id = 'A', title = 'Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='3hxg', asym_id='A', title='Structural insights into parasite EIF4E binding specificity for m7G and m2,2,7G mRNA cap.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003743,0005737,0006413', uniprot = '', pdbid = '3hxg', asym_id = 'A'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003743,0005737,0006413', uniprot='', pdbid='3hxg', asym_id='A')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>