Structure of PDB 3hsk Chain A

Receptor sequence

>3hskA (length=358) Species: 5476 (Candida albicans)

SVKKAGVLGATGSVGQRFILLLSKHPEFEIHALGASSRSAGKKYKDAASW
KQTETLPETEQDIVVQECKPEGNFLECDVVFSGLDADVAGDIEKSFVEAG
LAVVSNAKNYRREKDVPLVVPIVNPEHIDVVENKVKQAVSKGGKKPGFII
CISNCSTAGLVAPLKPLVEKFGPIDALTTTTLQAISGVSGMDILDNIVPY
ISGEEDKLEWETKKILGGVNAEGTEFVPIPESEMKVSAQCNRVPVIDGHT
ECISLRFANRPAPSVEDVKQCLREYECAASKLGCHSAPKQTIHVLDQPDR
PQPRLDRDRDSGYGVSVGRIREDSLLDFKMVVLSHNTIIGAAGAGILIAE
ILKAKNII

3D structure

• PDB: 3hsk Expansion of the aspartate beta-semialdehyde dehydrogenase family: the first structure of a fungal ortholog.
• Chain: A
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 1.2.1.11: aspartate-semialdehyde dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	A	G10 T12 G13 A36 S37 S40 D86 V89	G9 T11 G12 A35 S36 S39 D85 V88

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0004073 aspartate-semialdehyde dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
• GO:0046983 protein dimerization activity
• GO:0050661 NADP binding
• GO:0051287 NAD binding

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0008652 amino acid biosynthetic process
• GO:0009086 methionine biosynthetic process
• GO:0009088 threonine biosynthetic process
• GO:0009089 lysine biosynthetic process via diaminopimelate
• GO:0009090 homoserine biosynthetic process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:3hsk, PDBe:3hsk, PDBj:3hsk
• PDBsum: 3hsk
• PubMed: 20124701
• UniProt: Q5ALM0