Structure of PDB 3hsb Chain A

Receptor sequence

>3hsbA (length=67) Species: 1423 (Bacillus subtilis)

NIQDQFLNQIRKENTYVTVFLLNGFQLRGQVKGFDNFTVLLESEGKQQLI
YKHAISTFAPQKNVQLE

3D structure

• PDB: 3hsb Crystal structure of Hfq from Bacillus subtilis in complex with SELEX-derived RNA aptamer: insight into RNA-binding properties of bacterial Hfq
• Chain: A
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	A	F24 L25 N27 G28 F29 Q30 S60 T61	F20 L21 N23 G24 F25 Q26 S56 T57

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0043487 regulation of RNA stability
• GO:0045974 regulation of translation, ncRNA-mediated

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:3hsb, PDBe:3hsb, PDBj:3hsb
• PDBsum: 3hsb
• PubMed: 22053080
• UniProt: O31796|HFQ_BACSU RNA-binding protein Hfq (Gene Name=hfq)