Structure of PDB 3hrw Chain A

Receptor sequence
>3hrwA (length=141) Species: 10090 (Mus musculus) [Search protein sequence]
VLSGEDKSNIKAAWGKIGGHGAEYGAEALERMFASFPTTKTYFPHFDVSH
GSAQVKGHGKKVADALASAAGHLDDLPGALSALSDLHAHKLRVDPVNFKL
LSHCLLVTLASHHPADFTPAVHASLDKFLASVSTVLTSKYR
3D structure
PDB3hrw Crystal structure of hemoglobin from mouse (Mus musculus) compared with those from other small animals and humans.
ChainA
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 HEM A Y42 F43 H58 K61 V62 L83 L86 H87 L91 N97 L101 L136 Y42 F43 H58 K61 V62 L83 L86 H87 L91 N97 L101 L136
Gene Ontology
Molecular Function
GO:0005344 oxygen carrier activity
GO:0005506 iron ion binding
GO:0019825 oxygen binding
GO:0020037 heme binding
GO:0046872 metal ion binding
Biological Process
GO:0001701 in utero embryonic development
GO:0009617 response to bacterium
GO:0015670 carbon dioxide transport
GO:0015671 oxygen transport
GO:0030185 nitric oxide transport
GO:0035634 response to stilbenoid
GO:0048821 erythrocyte development
Cellular Component
GO:0005833 hemoglobin complex
GO:0043209 myelin sheath

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:3hrw, PDBe:3hrw, PDBj:3hrw
PDBsum3hrw
PubMed33830076
UniProtP01942|HBA_MOUSE Hemoglobin subunit alpha (Gene Name=Hba)

[Back to BioLiP]