Structure of PDB 3hq9 Chain A

Receptor sequence

>3hq9A (length=312) Species: 35554 (Geobacter sulfurreducens)

ADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLYFDPRLSASHLI
SCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRAK
DLAEQAKGPVQAPVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTF
DNMAKAIEVFEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVA
CHGGLNLGGTGYFPFGVVEGRFAVTNTAKDEYVFRAPSLRNVAITYPYFH
SGVVWSLKEAVAVMGSAQFGIKLSDDESEAIAAFLGSLTGKQPKVVYPIM
PASTDATPRPRL

3D structure

• PDB: 3hq9 CcpA from Geobacter sulfurreducens is a basic di-heme cytochrome c peroxidase.
• Chain: A
• Resolution: 1.52 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E136
• Catalytic site (residue number reindexed from 1): E115
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	C73 C76 H77 R100 P103 F115 W116 E136 M137	C52 C55 H56 R79 P82 F94 W95 E115 M116
BS02	HEM	A	C219 C222 H223 F236 G237 V238 F267 R268 A269 P270 L272 Y281 F282 H283 M297 F302	C198 C201 H202 F215 G216 V217 F234 R235 A236 P237 L239 Y248 F249 H250 M264 F269
BS03	CA	A	N101 T278 P280	N80 T245 P247
BS04	OXL	A	Q132 A133	Q111 A112
BS05	BU3	A	Q114 F115 Q132	Q93 F94 Q111

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding

External links

• PDB: RCSB:3hq9, PDBe:3hq9, PDBj:3hq9
• PDBsum: 3hq9
• PubMed: 19735665
• UniProt: Q749D0