Structure of PDB 3hq8 Chain A

Receptor sequence

>3hq8A (length=315) Species: 35554 (Geobacter sulfurreducens)

ADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLYFDPRLSASHLI
SCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRAK
DLAEQAKGPVQAPKEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTF
DNMAKAIEVFEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVA
CHGGLNLGGTGYFPFGVVEKPAGRFAVTNTAKDEYVFRAPSLRNVAITYP
YFHSGVVWSLKEAVAVMGSAQFGIKLSDDESEAIAAFLGSLTGKQPKVVY
PIMPASTDATPRPRL

3D structure

• PDB: 3hq8 CcpA from Geobacter sulfurreducens is a basic di-heme cytochrome c peroxidase.
• Chain: A
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E136
• Catalytic site (residue number reindexed from 1): E115
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	C73 C76 H77 R100 P103 W116 V131 M137 R268	C52 C55 H56 R79 P82 W95 V110 M116 R238
BS02	HEM	A	W116 C219 C222 H223 G237 V238 R268 A269 P270 L272 F282 H283 M297 G298 F302	W95 C198 C201 H202 G216 V217 R238 A239 P240 L242 F252 H253 M267 G268 F272
BS03	CA	A	N101 T278 P280	N80 T248 P250

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding

External links

• PDB: RCSB:3hq8, PDBe:3hq8, PDBj:3hq8
• PDBsum: 3hq8
• PubMed: 19735665
• UniProt: Q749D0