Structure of PDB 3hq7 Chain A

Receptor sequence

>3hq7A (length=304) Species: 35554 (Geobacter sulfurreducens)

FAADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLYFDPRLSASH
LISCNTCHNVGLGGGDLQATSTGHKWQQGPINAPTVLNSVFNTAAKGPVQ
ASVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTFDNMAKAIEVFE
ATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVACHGGLNLGGTG
YFPFGVVEKPKGRFAVTNTAKDEYVFRAPSLRNVAITYPYFHSGVVWSLK
EAVAVMGSAQFGIKLSDDESEAIAAFLGSLTGKQPKVVYPIMPASTDATP
RPRL

3D structure

• PDB: 3hq7 CcpA from Geobacter sulfurreducens is a basic di-heme cytochrome c peroxidase.
• Chain: A
• Resolution: 2.31 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E136
• Catalytic site (residue number reindexed from 1): E104
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	C73 C76 H77 S90 T91 G92 H93 W95 Q96 I100 A102 P103 N111 A113 P130 S134 E182	C54 C57 H58 S71 T72 G73 H74 W76 Q77 I81 A83 P84 N92 A94 P98 S102 E150
BS02	HEM	A	C219 C222 H223 F236 A269 P270 L272 Y281 F282 H283 M297 F302	C187 C190 H191 F204 A228 P229 L231 Y240 F241 H242 M256 F261
BS03	CA	A	N101 T278 P280	N82 T237 P239

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding

External links

• PDB: RCSB:3hq7, PDBe:3hq7, PDBj:3hq7
• PDBsum: 3hq7
• PubMed: 19735665
• UniProt: Q749D0