Structure of PDB 3hq6 Chain A

Receptor sequence

>3hq6A (length=324) Species: 35554 (Geobacter sulfurreducens)

ADELQQRAQGLFKPVPAKAPTLKGNPASPVKVELGKMLYFDPRLSASHLI
SCNTCHNVGLGGGDLQATSTGHGWQKGPRNAPTVLNSVFNTAQFWDGRAK
DLAEQAKGPVQASVEMNNTPDQVVKTLNSIPDYVALFKKAFPGEKDPVTF
DNMAKAIEVFEATLITPDSPFDQYLKGKKKALDGKQTAGLKLFLDKGCVA
CHGGLNLGGTGYFPFGVVEKPAENILPLGDKGRFAVTNTAKDEYVFRAPS
LRNVAITYPYFHSGVVWSLKEAVAVMGSAQFGIKLSDDESEAIAAFLGSL
TGKQPKVVYPIMPASTDATPRPRL

3D structure

• PDB: 3hq6 CcpA from Geobacter sulfurreducens is a basic di-heme cytochrome c peroxidase.
• Chain: A
• Resolution: 2.0 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): E136
• Catalytic site (residue number reindexed from 1): E115
• Enzyme Commision number: 1.11.1.5: cytochrome-c peroxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	A	C73 C76 H77 S90 T91 G92 H93 W95 Q96 R100 A102 P103 N111 W116 E182	C52 C55 H56 S69 T70 G71 H72 W74 Q75 R79 A81 P82 N90 W95 E161
BS02	HEM	A	C219 C222 H223 R268 A269 P270 L272 Y281 F282 H283 M297 F302	C198 C201 H202 R247 A248 P249 L251 Y260 F261 H262 M276 F281
BS03	CA	A	N101 T278 P280	N80 T257 P259

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding

External links

• PDB: RCSB:3hq6, PDBe:3hq6, PDBj:3hq6
• PDBsum: 3hq6
• PubMed: 19735665
• UniProt: Q749D0