Structure of PDB 3hmf Chain A |
>3hmfA (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] |
SMSPAYLKEILEQLLEAIVVATNPSGRLISELFQKLPSKVQYPDYYAIIK EPIDLKTIAQRIQNGSYKSIHAMAKDIDLLAKNAKTYNEPGSQVFKDANS IKKIFYMKKAEIEHHE |
|
PDB | 3hmf Histone recognition and large-scale structural analysis of the human bromodomain family. |
Chain | A |
Resolution | 1.63 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
H290 E291 |
H115 E116 |
|
|
|
|